Skip to content
Scan a barcode
Scan
Paperback 10990 kaashiiraameishvarayaatradarpand-amu [Telugu] Book

ISBN: 1149211210

ISBN13: 9781149211212

10990 kaashiiraameishvarayaatradarpand-amu [Telugu]

"10990 kaashiiraameishvarayaatradarpand-amu" is a Telugu travelogue documenting a pilgrimage to Kaashi (Varanasi), a city of immense religious significance in Hinduism. Written by subramand-yan'pan'd'itulu subramand-yan'pan'd'itulu and published in 1917, the book provides a historical snapshot of travel conditions and religious practices of the time. This text offers insights into the experiences of pilgrims, the sacred sites visited, and the cultural context of early 20th-century India. A valuable resource for those interested in Hindu pilgrimage traditions and the history of travel in India.

This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible. Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.

This work is in the public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.

As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures, errant marks, etc. Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. We appreciate your support of the preservation process, and thank you for being an important part of keeping this knowledge alive and relevant.

Recommended

Format: Paperback

Condition: New

$20.06
Ships within 2-3 days
Save to List

Related Subjects

Travel

Customer Reviews

0 rating
Copyright © 2026 Thriftbooks.com Terms of Use | Privacy Policy | Do Not Sell/Share My Personal Information | Cookie Policy | Cookie Preferences | Accessibility Statement
ThriftBooks® and the ThriftBooks® logo are registered trademarks of Thrift Books Global, LLC
GoDaddy Verified and Secured